Letterboxd 3k1s3a pramitheus https://letterboxd.voirfilms24.com/pramitheus/ Letterboxd - pramitheus Deep Cover z6i1e 2025 - ★★★½ https://letterboxd.voirfilms24.com/pramitheus/film/deep-cover-2025/ letterboxd-review-913329237 Wed, 11 Jun 2025 17:30:01 +1200 2025-06-11 No Deep Cover 2025 3.5 1239193 <![CDATA[

321w3b

it's kinda doing a reverse-barry, where improv comedians infiltrate a crime ring & keep going deeper & deeper into the mess. not really reinventing the wheel with the twists & turns; most of it is pretty predictable. i think it takes way too much time to actually throw the trio off the deep end. the performances are top notch, especially orlando bloom, which is what keeps things really engaging. there's a police chase that reminded me of hot fuzz. also sonoya mizuno is so hot!

]]>
pramitheus
Echo Valley 5l545 2025 - ★★★★★ https://letterboxd.voirfilms24.com/pramitheus/film/echo-valley/ letterboxd-review-911872570 Tue, 10 Jun 2025 03:47:55 +1200 2025-06-09 No Echo Valley 2025 5.0 1097311 <![CDATA[

that third act just made the movie for me. all the setups, and all the payoffs were so satisfying. top notch writing. the visuals were so good. all the performances were excellent, but julianne moore was a cut above the rest.

ALSO, HAPPY FUCKING PRIDE MONTH!

]]>
pramitheus
Diablo 6s1o6j 2025 - ★★★★½ https://letterboxd.voirfilms24.com/pramitheus/film/diablo-2025/ letterboxd-review-911625854 Mon, 9 Jun 2025 19:44:24 +1200 2025-06-09 No Diablo 2025 4.5 1127110 <![CDATA[

scott adkins versus an absolutely freaky ass marko zaror was extremely fun! has a generic story. but the punch-ups are too good, man.

]]>
pramitheus
Housefull 5 63j12 2025 - ★★ Housefull 5 63j12 2025 - ★★ https://letterboxd.voirfilms24.com/pramitheus/film/housefull-5/ letterboxd-review-909474728 Sat, 7 Jun 2025 19:17:07 +1200 2025-06-07 No Housefull 5 2025 2.0 1146210 <![CDATA[

great title reveal. this is the last place where I expected to see giallo lighting. there's a parrot-killing scene that actually had me in splits. shreyas talpade's surname is siliguriwala, so, how the fuck i am supposed to hate on that? the 1st 2 movies were ass but had good songs. 3rd was ass with no good songs. 4th had some bops. this one has bangers throughout, which is great. riteish sweating while being interrogated is a jordan peele sketch or airplane reference. usual suspects reference with akki, bhidu, & baba. lots of ekta kapoor reference with shock reaction. glass onion emergency light reference. "there are always 2 killers" scream reference. absolutely diabolical malaika arora joke. it has a blooper reel, which is weirdly censored, like the rest of the film. ALSO, NOT ENOUGH AAKHRI PASTA. they should have made him the investigator instead of nana tbh.

the sexualisation (especially of lucy, who does get to a basic instinct homage though) & stereotyping are through the roof, which is kinda the staple of the franchise at this point. until the characters end up in jail in the 1st half, it has some form of momentum, but after that, it really nosedives & doesn't recover. the final rotor sequence must've been fun to shoot but it's painful to sit through. that moment where both baba and bhidu use their bodies to shield julius from being shot, but both of them miss, and julius does end up getting shot is the only funny bit in the entire 3rd act. lots of ai generated pics towards the end. much like 4 this is relatively plot-focused instead of being a string of skits, but I think nadiadwala and mansukhani don't know how to make a crime scene legit funny. they try but ultimately they resort to screaming loudly or upskirt jokes. neither of the killer reveals (A or B) were interesting. so, ya, there you go.

]]>
pramitheus
The Survivors 1o6251 2025 - ★★★★ https://letterboxd.voirfilms24.com/pramitheus/film/the-survivors-2025/ letterboxd-review-909281410 Sat, 7 Jun 2025 14:09:29 +1200 2025-06-04 No The Survivors 2025 4.0 284605 <![CDATA[

better than most netflix shows about families or communities coming apart at the seams due to a single action of crime. great visuals. splendid acting. also, yerin ha🫠😍💞.

]]>
pramitheus
K.O. 46l4p 2025 - ★★★★★ https://letterboxd.voirfilms24.com/pramitheus/film/ko-2025-1/ letterboxd-review-908703613 Fri, 6 Jun 2025 23:01:11 +1200 2025-06-06 No K.O. 2025 5.0 1450599 <![CDATA[

ABSOLUTE CINEMA.

]]>
pramitheus
John Wick 71a1u Chapter 4, 2023 - ★★★★★ https://letterboxd.voirfilms24.com/pramitheus/film/john-wick-chapter-4/6/ letterboxd-watch-908644026 Fri, 6 Jun 2025 20:03:33 +1200 2025-06-06 Yes John Wick: Chapter 4 2023 5.0 603692 <![CDATA[

Watched on Friday June 6, 2025.

]]>
pramitheus
John Wick 71a1u Chapter 3 – Parabellum, 2019 - ★★★★★ https://letterboxd.voirfilms24.com/pramitheus/film/john-wick-chapter-3-parabellum/2/ letterboxd-watch-908491674 Fri, 6 Jun 2025 14:55:49 +1200 2025-06-06 Yes John Wick: Chapter 3 – Parabellum 2019 5.0 458156 <![CDATA[

Watched on Friday June 6, 2025.

]]>
pramitheus
John Wick 71a1u Chapter 2, 2017 - ★★★★★ https://letterboxd.voirfilms24.com/pramitheus/film/john-wick-chapter-2/2/ letterboxd-watch-907900910 Thu, 5 Jun 2025 22:01:53 +1200 2025-06-05 Yes John Wick: Chapter 2 2017 5.0 324552 <![CDATA[

Watched on Thursday June 5, 2025.

]]>
pramitheus
John Wick 71a1u 2014 - ★★★★★ https://letterboxd.voirfilms24.com/pramitheus/film/john-wick/2/ letterboxd-watch-906255656 Tue, 3 Jun 2025 21:03:37 +1200 2025-06-03 Yes John Wick 2014 5.0 245891 <![CDATA[

Watched on Tuesday June 3, 2025.

]]>
pramitheus
Mission 1o81a Impossible – The Final Reckoning, 2025 - ★★★★★ https://letterboxd.voirfilms24.com/pramitheus/film/mission-impossible-the-final-reckoning/2/ letterboxd-review-905363965 Mon, 2 Jun 2025 20:48:53 +1200 2025-06-02 Yes Mission: Impossible – The Final Reckoning 2025 5.0 575265 <![CDATA[

earth: luther's lair, the doomsday vault
fire: fight at donloe's house, steamy underpants fight
water: sevastopol extraction
air: biplane wing walking

ethan hunt is the fucking avatar.

]]>
pramitheus
Housefull 4 p2m39 2019 - ★★½ https://letterboxd.voirfilms24.com/pramitheus/film/housefull-4/ letterboxd-review-904424079 Mon, 2 Jun 2025 02:01:13 +1200 2025-06-01 No Housefull 4 2019 2.5 611748 <![CDATA[

it's ironic that i'm watching this on pride month. this was totally coincidental. i swear i didn't plan this. on that note, here's all the lgtbq "representation" the movie has. in the 1400s, riteish deshmukh's character plays a guy who pretends to be gay but is actually in love with pooja hegde. riteish's reincarnated form keeps mixing up genders while talking & is apparently in touch with his feminine side. present day pooja hegde tells present day kriti kharbanda that present day kriti sanon "stole her man" by telling that kharbanda was lesbian. in the 1400s, jamie lever plays, giggly, akhri pasta's love interest, & she is reincarnated as johnny lever, and they (?) become present day akhri pasta's lover.
present day kriti, kriti, & pooja's father tells bobby, akki, & riteish that they should be ashamed of "horsing" around girls half their age because bollywood has learned that if you address the age-gap then people supposedly won't mind it & think that the film is "self aware." that's followed by a horse-related death trap copied from final destination 3.
i'm gonna honest, "bala shaitan ka sala" & "ek chumma" are ear worms.
bala being genuinely disappointed that he doesn't have the blood of innocent people on his hands is funny.
bobby doing kanguva before kanguva as dharmputra.
the running joke where the dialogue is made of lyrics from a song, and one of the characters (usually pooja hegde) that it should be composed into a song, because that's what om shanti om did a lot & even coveted movies likes forrest gump have done where they show that a character influenced something that's popular in the present day.
bala saying "side please" in the 1400s made me laugh.
kharbanda in the 1400s accusing bobby of rape to make him her husband, in a franchise that was started by sajid khan, is umm sketchy.
the production design, art direction, & costume design in the 1400 sequence is insane. you can see that akki didn't eat up the whole budget & some of it actually went into making the visuals look & feel good.
takhliya (disperse) takleya (baldy) mix-up will always be funny to me.
there were a lot of baahubali references. LOTS. the three arrows becoming four. rana daggubati as khal drogo cuz the tribals in baahubali actually seemed to be ripped off from GOT, also rana was bhallaldeva. and sharad kelkar voices prabhas... in most of his movies? and there's a version of "jiyo re baahubali" which is hilarious.
okay, i genuinely love the fact that it is an uphill task to convince anyone that reincarnation has happened. the whole segment where akki is losing his mind & everyone else is losing their mind trying to understand what he is saying is great.
"tu bhaand hain. aur tu gadhe ki gaand hai!"
licker (chaatna) is turned into a chatterjee/chattopadhyay joke.
the nawazuddin sequence is great tbh. very camp.
aldab/badla mirror sequence mirroring redrum/murder from the shining with rana acting like the bear from annihilation is great.
the scene where rana loses his eyesight and he tries to kill everyone by hearing where they are but he keeps hitting akki only is funny. there's a recycled dhamaal joke, which in turn is probably copied from somewhere else.
i think the 2nd half becomes a bit too serious to establish the "reincarnated love" stuff, and how the "house full money stealing" shenanigans factor in, which really drags an already overlong movie.
also, kriti sanon, kriti kharbanda, and pooja hegde look amaze.
all in all, i had fun. probably the best out of the lot, which is not saying much.

]]>
pramitheus
Housefull 3 4m18n 2016 - ★★ https://letterboxd.voirfilms24.com/pramitheus/film/housefull-3/ letterboxd-review-903753807 Sun, 1 Jun 2025 09:36:44 +1200 2025-06-01 No Housefull 3 2016 2.0 391779 <![CDATA[

the disabilities mockery aspect of the film is kinda wild. it's introduced to spice up the whole "hiding one's identity" gimmick that the franchise has established. but then it becomes sincere about with a montage of the girls talking about how hypocritical they're being by using disabilities to facilitate their marriage. but then it kinda goes back to treating disabilities as a joke.
the first half did make me laugh quite a few times, again, mostly because of how preposterous the situation was.
at one point akki shouted "suck the ants out of my pants."
this seems like an abhishek bachchan dunkfest & advert. because, on one hand, you have an extended of his "rap" abilities, but on the other hand, he goes on and on about his dad, his wife, bunty-babli, pro-kabaddi league, and even how he has ed the franchise.
riteish has one genelia d'souza joke.
akshay's split-personality disorder after hearing the word "indian" is the best though because he didn't have an indian citizenship back then & he was doing one nationalistic one after another. he also copies a scene from fight club, the one where edward norton hits himself bloody in the office.
jackie shroff has 3 great moments: one, where he slits a guy's throat but it's implied by cracking a supari. two, where he rejects a proposal for human trafficking by drinking from a cup that reads "fcuk u" in the bottom. and three, where he says "we should use our hands for a cause, not just applause."
the sleazeshow was reduced, but there was a "women using fake sexual harassment charges to extort men" subplot, which, yea, no.
jacqueline, lisa, & nargis looked great.
songs sucked hard.
since the 2nd film had done a decent job of establishing the "housefull" aspect of the film, this one had an easier job of building on it. and while the 1st half is enjoyable, the 2nd half is just not it.
the dialogue writing tried to emulate max's way of talking in funny riddles & examples from the 2nd film via batook & his "daughters" & some of them hit, some of them miss. but max is max, man.

]]>
pramitheus
Housefull 2 577245 2012 - ★★ https://letterboxd.voirfilms24.com/pramitheus/film/housefull-2/ letterboxd-review-903127444 Sat, 31 May 2025 16:32:20 +1200 2025-05-31 No Housefull 2 2012 2.0 85052 <![CDATA[

max quotes:
1. "i don't know about italian, but i'll do the job."
2. "can't say about coins, but i have changed."
3. "can't say about george michael, but have faith in me."
4. "can't say about birla, but tata to you."
5. "can't say about ninjas, but we've become turtles."
6. "can't say about slumdog, but this is a millionaire's house."
7. "can't say about brad, but we're in this pit because of you."
8. "can't say about twentieth century, but you're the real fox."
9. "i thought that after your coma your life would come to a full stop."
10. (not said by max but inspired by max) "can't say about john, but jagga won't take mercy on you."

based on just that you can understand more effort has been put into the writing. no, it actually justifies its title because of its focus on the "house" aspect of "housefull."
there's a great match cut between a spinning scalpel & the blades of a helicopter.
last movie had a real tiger & this one had a real alligator (the shots used are pretty great).
shreyas talpade calls the snake that bit his dick "francis ford sapola."
akshay & john did a lot of their own stunts & it looked pretty great. you can even see in the bts stuff that it was painful. not an excuse to give up doing stunts entirely though.
there's a "short people are so funny" joke.
there's a character called dr. ranjeet v.asna k.pujari (the rapist) who is okay with sexually harassing girls but is strictly against "breaking their trust"??????
definitely had more skin-show than the last one.
john does a hercules-holding-the-world pose at one point.
riteish tries to do an ending explained which is actually funny.
this gave us the "lagta ye pagal ho gaya hai" meme.
banger songs.
so, somehow better than the 1st one, but that's not saying much.

]]>
pramitheus
Housefull 6h5b6 2010 - ★ https://letterboxd.voirfilms24.com/pramitheus/film/housefull/1/ letterboxd-review-902647083 Sat, 31 May 2025 06:22:48 +1200 2025-05-30 Yes Housefull 2010 1.0 58051 <![CDATA[

banger songs.
there's a french poster of william wyler's the collector in riteish deshmukh's house.
the film is apparently dedicated to manmohan desai; i don't know how.
the wildest moment in the film is probably when akshay kumar starts doing an "african dance" to prove that the baby, who is black, is his, & he just starts shouting "kalua."
there's a running "are they gay?" gag because in 2010, being gay was a joke?
sexual harassment, ironically enough, is used as a joke.
the "buckingham. please be silent. uckingham" joke & the character of aakhri pasta, that too in italy, are the legitimately funniest things in the entire movie.
jiah khan (rip), deepika padukone, lara dutta, & jacqueline fernandez looked really good.
the rest (along with the director) is garbage.

]]>
pramitheus
A Widow's Game 142364 2025 - ★★★½ https://letterboxd.voirfilms24.com/pramitheus/film/a-widows-game/ letterboxd-review-902405230 Fri, 30 May 2025 22:50:37 +1200 2025-05-30 No A Widow's Game 2025 3.5 1397832 <![CDATA[

props to maje for making so many idiotic men dance to her tunes.

]]>
pramitheus
Lost in Starlight k23p 2025 - ★★★ https://letterboxd.voirfilms24.com/pramitheus/film/lost-in-starlight/ letterboxd-review-901072888 Thu, 29 May 2025 09:08:54 +1200 2025-05-29 No Lost in Starlight 2025 3.0 1165642 <![CDATA[

narratively stale, visually over-stimulating. overall, a fine enough love story.

]]>
pramitheus
Edge of Tomorrow 2q1u1z 2014 - ★★★★★ https://letterboxd.voirfilms24.com/pramitheus/film/edge-of-tomorrow/1/ letterboxd-review-900085024 Wed, 28 May 2025 06:59:42 +1200 2025-05-27 Yes Edge of Tomorrow 2014 5.0 137113 <![CDATA[

one of the greatest sci-fi action movies of all time. the subtle shift in tone as it goes from being ha-ha-lol-time-loop to oh-fuck-it's-a-time-loop-so-time-to-be-existential is great. the efficiency in of building character, the lore, the tactics... brilliant stuff.
i think somebody had mentioned that mcquarrie basically did the death star trench run "but better" for top gun maverick. but, and bear with me for this one, before that, he did battle for zion "but better" for edge of tomorrow. think about it. think about it for a second. it's essentially the battle for zion with the neo-chosen-one-jesus metaphor integrated really seamlessly into the whole thing via cage.
i know that everyone wants a sequel to this. but after all these years, i'm like "what would you do in a sequel?" this is a perfect story told perfectly executed perfection. i'm happy with it.

]]>
pramitheus
Days of Thunder 2q5t2p 1990 - ★★★★½ https://letterboxd.voirfilms24.com/pramitheus/film/days-of-thunder/ letterboxd-review-899719085 Tue, 27 May 2025 18:43:46 +1200 2025-05-27 No Days of Thunder 1990 4.5 2119 <![CDATA[

tony scott was too good at doing homoeroticsm & enemies-to-i-love-you-so-much-that-i-will-give-my-life-for-you-type-lovers arc. what a visually-arresting movie. every shot is just fucking oozing style (only fans of indian mass cinema will probably appreciate tom cruise's "entry scene"). great performances from all. the rivalry between tom cruise & michael rooker & then their camaraderie. absolutely beautiful.
i think the movie should've been longer to truly allow the interpersonal drama & the exhilaration of the race sequences to set in.
i love the fact that robert duvall tells tom cruise whether is afraid of being beaten up by a 60-year-old guy & now tom cruise is in his 60s outrunning & one-upping dudes half his age. i really love the fact that after all the display of machismo & alpha male-ism is done, all the men drop their guards & be vulnerable, thereby making that the fuel to progress the plot, the relationship, the themes etc.
i didn't know that the last 2 mission: impossible movies were kind of a days of thunder reunion for cruise & cary elwes. also, OHHHHMYGOD nicole kidman looked so stunning here. absolutely ethereal.
do i think a days of thunder: trickle legacy sequel can be done? i don't know what kinda cult following this has. also, joseph kosinski has already done f1, which kinda feels like a pseudo legacy sequel to this. but ya, i'll watch anything with tom cruise in it. so, why not?

]]>
pramitheus
Collateral 5m43z 2004 - ★★★★★ https://letterboxd.voirfilms24.com/pramitheus/film/collateral/1/ letterboxd-review-899047782 Tue, 27 May 2025 05:16:01 +1200 2025-05-26 Yes Collateral 2004 5.0 1538 <![CDATA[

one of the greatest movies of all time? yeah, one of the greatest movies of all time. tom cruise looking & moving like a humanoid hybrid of a shark & a raptor. absolutely fucking sinister. the way he switches from existential hitman to i'm-gonna-rip-your-fucking-head-off hitman is just bloody sublime. jamie foxx is so amazing too. the moment where he has to be "vincent" is so good & when he finally snaps & "takes control" of his life... great. also, mark ruffalo, javier bardem, peter berg (?????), jada pinkett smith, & jason fucking statham showing up, giving great performances & fucking off... amazing.
i don't think anybody can make cityscapes look like these mythical places where some mystical powers are running every nook and cranny instead of electricity like michael mann does. it's all so hypnotic with the music, the editing, the shot choices, & yet grounded in reality; idk how he does it. that club shootout sequence would've been the greatest club shootout sequence in the history of club shootout sequences if john wick 4 hadn't topped it a few years later. but it's still such a hoot. vincent talking about jazz reminded me of ethan hunt talking about jazz in rogue nation. and that ending??? omg. banger all the way.

]]>
pramitheus
Valkyrie 3z6h1n 2008 - ★★★★½ https://letterboxd.voirfilms24.com/pramitheus/film/valkyrie/ letterboxd-review-898662979 Mon, 26 May 2025 17:14:06 +1200 2025-05-26 Yes Valkyrie 2008 4.5 2253 <![CDATA[

just learned that this was co-written by christopher mcquarrie, which is why i rewatched it. or else i would've never rewatched a fucking bryan singer movie.
i wonder what people learned from movies like this & schindler's list (whose director is now ing a genocide btw). you had literal nazi officers defecting against bloody adolf hitler & nowadays it's apparently blasphemy to even think about speaking up against the oppressive & violent acts being perpetrated by "world leaders" like netanyahu, putin, modi, etc. idc what people in their "inner circle" think, but what about the general public? they've become more subservient. they love gobbling up that fascist ideology. and they'll probably be the first in line to chastise all the modern-day stauffenbergs. ya sure, hitler is dead, but fascism is in vogue more than ever.

]]>
pramitheus
American Made v3p4r 2017 - ★★★★½ https://letterboxd.voirfilms24.com/pramitheus/film/american-made/ letterboxd-review-897966384 Mon, 26 May 2025 05:50:14 +1200 2025-05-25 No American Made 2017 4.5 337170 <![CDATA[

this was pretty amazing. the humor, the tackiness, the grime, and the politics of it all was presented in such a great way. also, tom cruise got to fly a lot of planes in a lot of sketchy ways. the timing of the movie's release must've been something. also, after reading up on usa's involvement in south american politics for the eternaut & central american politics through this film, i finally learned about the true meaning of the contras. as kids we used to play a fucking game called contras. that's the power of propaganda: getting kids to play as a member of a contra unit without understanding its underlying connotations.

anyway, this was great. fantastic pacing. i like how doug liman's visual storytelling has become so frenetic over the years. hope to see tom cruise go back to doing character-focused roles like this since his mission: impossible days are over (for now).

]]>
pramitheus
Mission 1o81a Impossible – The Final Reckoning, 2025 - ★★★★★ https://letterboxd.voirfilms24.com/pramitheus/film/mission-impossible-the-final-reckoning/1/ letterboxd-review-897720303 Mon, 26 May 2025 00:19:56 +1200 2025-05-25 Yes Mission: Impossible – The Final Reckoning 2025 5.0 575265 <![CDATA[

re-watched with maa. she said that lucy tulugarjuk should get an oscar for her performance. she really liked pom klementieff's performance too. she thinks shea wigham looks a lot like michael douglas. she did think that the 1st act was lengthy, but maybe necessary cuz she hadn't watched the previous movies recently. she thought that the biplane sequence was a lot to take in. she complimented the film for its anti-war & anti-a.i. message. and she is really impressed with tom cruise's tenacity for doing death-defying stuff. she understands why the franchise has to come to an end, and at the same time she is sad that it has come to an end, especially because (despite not being a die hard fan of action) she has always loved the action of these mission: impossible films.

i've already written my extended thoughts across several articles. here are some additional notes. i cried as soon as that luther scene began. i mean, full tears trickling down my face. unlike everyone, i really don't have any problems with the 1st act, especially on the re-watch. all the actors in the cast talk so eloquently & have these micro-expressions, coupled with the lighting, camera, sound, edits, that make all those verbose dialogue scenes so interesting to watch. i think that submarine scene has the greatest use of a rotating set since inception & high school musical 3. the fact that you can see the water shift & move & become the ceiling, holy fucking shit. what can i say about the biplane sequence that hasn't been said already? i was gripping my bag so tight that it left marks on my hand. that shit is intense AF. also, great audience. generally, people who show up on the 2nd week, that too on a sunday, are not all that dedicated viewers of cinema & have merely hopped on the hype-wagon. but i guess it wasn't the case this time. great reactions from all at the perfect moments. saw an elderly couple, probably in their late 60s or early 70s, and call me existential hunt cuz that kinda got me melancholic for the obvious reasons.

anyway i had a great time. i know that there are many "action" movies coming out this year. so, yeah, be prepared to be compared with this.

]]>
pramitheus
Dead Weight 4d42n ★★★★ https://letterboxd.voirfilms24.com/pramitheus/film/dead-weight-1/ letterboxd-review-896917429 Sun, 25 May 2025 07:24:15 +1200 2025-05-25 No Dead Weight 4.0 1392438 <![CDATA[

probably the most brightest and colorful-looking post-apocalyptic story that i've seen since carol & the end of the world. also, i think it's commenting on the recent rise of alpha male podcasters who keep saying that society should revert to the old ways, where men were hunters and women were caregivers. but the short film says that when push comes to shove, men will do what men always do; find reasons to hurt women. the problem they'll (hopefully) face is that women will one-up them.

]]>
pramitheus
Fountain of Youth 171v3i 2025 - ★★★★ https://letterboxd.voirfilms24.com/pramitheus/film/fountain-of-youth-2025/ letterboxd-review-894952613 Fri, 23 May 2025 02:31:37 +1200 2025-05-22 No Fountain of Youth 2025 4.0 1098006 <![CDATA[

not as good as indiana jones and the last crusade, but better than indiana jones and the dial of destiny.

]]>
pramitheus
Fear Street 4ls68 Prom Queen, 2025 - ★ https://letterboxd.voirfilms24.com/pramitheus/film/fear-street-prom-queen/ letterboxd-review-893362640 Wed, 21 May 2025 02:37:39 +1200 2025-05-20 No Fear Street: Prom Queen 2025 1.0 1001414 <![CDATA[

BRING BACK LEIGH JANIAK!

]]>
pramitheus
Fear Street 4ls68 1666, 2021 - ★★★★½ https://letterboxd.voirfilms24.com/pramitheus/film/fear-street-1666/1/ letterboxd-watch-893187541 Tue, 20 May 2025 18:38:37 +1200 2025-05-20 Yes Fear Street: 1666 2021 4.5 591275 <![CDATA[

Watched on Tuesday May 20, 2025.

]]>
pramitheus
Fear Street 4ls68 1978, 2021 - ★★★★ https://letterboxd.voirfilms24.com/pramitheus/film/fear-street-1978/1/ letterboxd-watch-892749725 Tue, 20 May 2025 08:16:20 +1200 2025-05-20 Yes Fear Street: 1978 2021 4.0 591274 <![CDATA[

Watched on Tuesday May 20, 2025.

]]>
pramitheus
Fear Street 4ls68 1994, 2021 - ★★★★ https://letterboxd.voirfilms24.com/pramitheus/film/fear-street-1994/1/ letterboxd-watch-892658222 Tue, 20 May 2025 06:09:32 +1200 2025-05-19 Yes Fear Street: 1994 2021 4.0 591273 <![CDATA[

Watched on Monday May 19, 2025.

]]>
pramitheus
Mission 1o81a Impossible – The Final Reckoning, 2025 - ★★★★★ https://letterboxd.voirfilms24.com/pramitheus/film/mission-impossible-the-final-reckoning/ letterboxd-review-890386868 Sat, 17 May 2025 22:05:50 +1200 2025-05-17 No Mission: Impossible – The Final Reckoning 2025 5.0 575265 <![CDATA[

i cried bro.

]]>
pramitheus
Mission 1o81a Impossible – Dead Reckoning, 2023 - ★★★★★ https://letterboxd.voirfilms24.com/pramitheus/film/mission-impossible-dead-reckoning/6/ letterboxd-watch-889581571 Fri, 16 May 2025 23:26:50 +1200 2025-05-16 Yes Mission: Impossible – Dead Reckoning 2023 5.0 575264 <![CDATA[

Watched on Friday May 16, 2025.

]]>
pramitheus
Mission 1o81a Impossible – Fallout, 2018 - ★★★★★ https://letterboxd.voirfilms24.com/pramitheus/film/mission-impossible-fallout/6/ letterboxd-watch-889108559 Fri, 16 May 2025 08:09:13 +1200 2025-05-15 Yes Mission: Impossible – Fallout 2018 5.0 353081 <![CDATA[

Watched on Thursday May 15, 2025.

]]>
pramitheus
Mission 1o81a Impossible – Rogue Nation, 2015 - ★★★★★ https://letterboxd.voirfilms24.com/pramitheus/film/mission-impossible-rogue-nation/3/ letterboxd-watch-888847858 Thu, 15 May 2025 23:21:39 +1200 2025-05-15 Yes Mission: Impossible – Rogue Nation 2015 5.0 177677 <![CDATA[

Watched on Thursday May 15, 2025.

]]>
pramitheus
Mission 1o81a Impossible – Ghost Protocol, 2011 - ★★★½ https://letterboxd.voirfilms24.com/pramitheus/film/mission-impossible-ghost-protocol/4/ letterboxd-watch-888274755 Thu, 15 May 2025 05:52:32 +1200 2025-05-14 Yes Mission: Impossible – Ghost Protocol 2011 3.5 56292 <![CDATA[

Watched on Wednesday May 14, 2025.

]]>
pramitheus
Mission 1o81a Impossible III, 2006 - ★★★★ https://letterboxd.voirfilms24.com/pramitheus/film/mission-impossible-iii/3/ letterboxd-watch-888070495 Wed, 14 May 2025 22:10:33 +1200 2025-05-14 Yes Mission: Impossible III 2006 4.0 956 <![CDATA[

Watched on Wednesday May 14, 2025.

]]>
pramitheus
Mission 1o81a Impossible II, 2000 - ★★★★★ https://letterboxd.voirfilms24.com/pramitheus/film/mission-impossible-ii/3/ letterboxd-watch-887538153 Wed, 14 May 2025 06:32:51 +1200 2025-05-13 Yes Mission: Impossible II 2000 5.0 955 <![CDATA[

Watched on Tuesday May 13, 2025.

]]>
pramitheus
Mission 1o81a Impossible, 1996 - ★★★★★ https://letterboxd.voirfilms24.com/pramitheus/film/mission-impossible/3/ letterboxd-watch-887420667 Wed, 14 May 2025 02:54:11 +1200 2025-05-13 Yes Mission: Impossible 1996 5.0 954 <![CDATA[

Watched on Tuesday May 13, 2025.

]]>
pramitheus
Secrets We Keep f12r 2025 - ★★★★ https://letterboxd.voirfilms24.com/pramitheus/film/secrets-we-keep/ letterboxd-review-885906102 Mon, 12 May 2025 07:32:31 +1200 2025-05-12 No Secrets We Keep 2025 4.0 262878 <![CDATA[

this is in a way the complete opposite of adolescence. please keep your blood pressure pills or whatever keeps you calm by your side while watching because OMFG there's a family that's gonna get on your nerves. also, don't marry. don't have kids. there's enough shitbags running around in this planet. please, stop. in of storytelling, i think it reserves way too much for the last 2 episodes. everything before it is way too muted to be impactful. it's a really slow drip to the extent that you may not notice something is dripping. but ya, essential viewing.

]]>
pramitheus
Saw X 3d3u27 2023 - ★★★★★ https://letterboxd.voirfilms24.com/pramitheus/film/saw-x/ letterboxd-review-885689768 Mon, 12 May 2025 02:59:35 +1200 2025-05-11 No Saw X 2023 5.0 951491 <![CDATA[

this was an unexpectedly good interquel. everything about the premise was making me think "how the fuck are they gonna pull that off?" and those opening 30 minutes made me think "wtf are they doing with this shit?" but then the revelation happened & i was like "ohhhhhhhhhhhhh amazing." it does peak a little early with that first contraption (which btw are very rudimentary and hence incredibly gnarly), and then maintained it till the very end. that finale was a tad bit predictable but when that "blood-boarding" began, i thought we were gonna get a deus ex machina cuz i saw no way to get out of that situation. nope. all part of the plan. and while the franchise has always oscillated between critique of the healthcare system & the justice system, doing one on healthcare scam in the 2020s is pretty relevant. really great performances. amanda young back with that hotness quotient; cecilia & gabriela were baddies too. and man, what a performance from tobin bell. loved it (almost puked several times).

also the mid-credits? can make a grown man scream out loud.

]]>
pramitheus
Spiral 1i93z From the Book of Saw, 2021 - ★★★½ https://letterboxd.voirfilms24.com/pramitheus/film/spiral-from-the-book-of-saw/1/ letterboxd-review-885618439 Mon, 12 May 2025 00:52:15 +1200 2025-05-11 Yes Spiral: From the Book of Saw 2021 3.5 602734 <![CDATA[

i'm sorry spiralfromthebookofsaw, i think i judged you too harshly. this is a perfectly decent entry in the franchise. previous entries have been famously ACAB, but this one quadruples down on it. the contraptions are either a bit derivative or not as diabolical, but they are all thematically relevant. the performances are good, with chris rock giving the type of hammy performance that i thought was missing from jigsaw. the visuals are iffy. you can clearly see it's going for that summer-heat tony scott-esque look, but the coloring is so inconsistent that there are these weird patches all over the print. and if it wasn't clear before, it's clearer now that this is the spiritual sequel franchise to se7en, with this one having mills be john doe. also, watching this after watching its predecessors kinda makes the 2000s-esque edits and tonality more bearable.

]]>
pramitheus
Jigsaw 4ux2j 2017 - ★★★★ https://letterboxd.voirfilms24.com/pramitheus/film/jigsaw-2017/ letterboxd-review-885576363 Sun, 11 May 2025 23:21:15 +1200 2025-05-11 No Jigsaw 2017 4.0 298250 <![CDATA[

maybe not as intense as the previous entries, which is probably due to modern acting aiming for realism instead of hamming shit up. still, decent enough performances. and it's kinda obvious from the start that the 2 things are not happening at the same time. yet, it's difficult to figure out how the corpses are showing up from a test that happened 10 years ago fresh and bloody. and ya, the final revelation, with the music & the on-the-nose commentary about corrupt police not caring about the victims of the criminals they are letting go for one reason or the other got me hyped. the barnyard shenanigans, especially the spiral tornado thingy are pretty decent contraptions. jigsaw's apprenticeship program is truly wild and expansive. i'm sure someone has already broken down the timeline & whatnot & sucked the fun out of the retcons. since i'm not cinemasins-pilled, idc about "factual errors" & that's why i really enjoy how this franchise constantly manages to bring back the legendary tobin bell just because he is too awesome. aslo, and i mean this respectfully, but eleanor had me tweaking; good job to her for amping up the hotness factor of the film.

]]>
pramitheus
Saw 3D 4b4vm 2010 - ★★★★½ https://letterboxd.voirfilms24.com/pramitheus/film/saw-3d/ letterboxd-review-885532554 Sun, 11 May 2025 21:40:27 +1200 2025-05-11 No Saw 3D 2010 4.5 41439 <![CDATA[

HOW THE FUCK DID FUCKING BOBBY, SHITRAG BOBBY, LYINGPIECEOFSHIT BOBBY, CAN'TCOMPLETEATASKEVENIFHISLIFEDEPENDSONIT BOBBY BAGGED 3 FUCKING HOTTIES is beyond me. just beyond me. but ya, his whole arc, the tasks, and that last contraption which looked like a giant pig was undeniably baller. much like scream, it did a good job of commenting on the commercialization and bastardization of the "true crime" genre before it became a netflix phenomenon. john showing up for a book g like he's about to drop the hottest rap album ever was excellent. the reintroduction of gordon (that too to bring an end to hoffman's unhinged reign), mommy jill serving looks before getting murked, and hoffman going absolutely cop-killing apeshit was incredibly fun to watch. the opening "guys rock, girl shocked" moments was lowkey hilarious. also chester bennington (rip) cameo was pretty cool. the only real complaint i have against this film is that it looks VOD-esque. this deserved better cinematography & editing. and obviously the "hey you're watching a movie that's been made for 3D" moments haven't aged well.

]]>
pramitheus
Saw VI 3v5t5l 2009 - ★★★★★ https://letterboxd.voirfilms24.com/pramitheus/film/saw-vi/ letterboxd-review-885443914 Sun, 11 May 2025 18:17:11 +1200 2025-05-11 No Saw VI 2009 5.0 22804 <![CDATA[

i'm sure there was some criticism for 5. so they locked the fuck in for this one because this was fantastic. kramer punishing a health insurance agent is perfect. that whole monologue about how we pay for treatments that we don't want vs how we should pay for treatments that we need is so so goddamn relevant. every puzzle laid before that insurance guy is pitch perfect, with the best one being the carousel ofc. ohmygod, the performances that everyone give in that small sequence is absolutely fan-fucking-tastic. the final revelation that the insurance guy's whole journey was for nothing & it was ultimately in the hands of the wife of the guy whose insurance he had rejected???!!! wow, whattatwist! also, insurance guy's death-by-acid... fuuucccking hell. hoffman being an unworthy successor & becoming more & more unhinged is just, wow. great performance from costas mandylor (who is keep confusing for louis mandylor cuz they look the same).

betsy russell & samantha lemole brought sexy back into the franchise. also, melanie scrofano going from this to starring in ready or not is pretty cool imo.

]]>
pramitheus
Saw V 711q2t 2008 - ★★★★ https://letterboxd.voirfilms24.com/pramitheus/film/saw-v/ letterboxd-review-884918727 Sun, 11 May 2025 07:39:47 +1200 2025-05-10 No Saw V 2008 4.0 11917 <![CDATA[

the contraptions are elaborate AF. i love jigsaw's recruitment program. the performances from everyone are amazing, especially during that hand-slicing scene at the end. there's still that emotional throughline of turning vengeance (or some other negative emotion) into something productive. and using these "tests" to weed out one's worst instincts and lead with empathy & humanity. but i think this entry gets a little too busy explaining the plot machinations instead of focusing on the emotions. like the whole police subplot & the subplot of those 5 people seemed weak. the theme of capitalism & corruption was fine, i just think the link between the subplots wasn't explored well enough. btw since i the pendulum & that hand-slicing & the glass box ending, i think this was the first saw movie that i had watched (yes, i was too young to be watching this shit). despite my criticisms, i still find this to be enjoyable.

]]>
pramitheus
Saw IV 4a3e5g 2007 - ★★★★½ https://letterboxd.voirfilms24.com/pramitheus/film/saw-iv/ letterboxd-review-884814128 Sun, 11 May 2025 05:18:45 +1200 2025-05-10 No Saw IV 2007 4.5 663 <![CDATA[

i know some people have some people have said this already but i have to say it: saw is the spiritual sequel franchise of se7en, and i mean that as a compliment.

the plot continues to get more and more complicated. the gotcha-s continue to become more and more gotcha-y. the posthumous web-weaving is truly impressive. i think the back story is pretty solid. the contraptions are so elaborate. the performances are so fucking high-octane. the death of that rapist is really satisfying. the whole theme of obsession & knowing when to give up is pretty good. the pacing issues are there, which is almost covered by those wild af transitions. no hotness factor though, unfortunately.

]]>
pramitheus
Saw III 503465 2006 - ★★★★½ https://letterboxd.voirfilms24.com/pramitheus/film/saw-iii/ letterboxd-review-884696469 Sun, 11 May 2025 02:07:37 +1200 2025-05-10 No Saw III 2006 4.5 214 <![CDATA[

the pacing might've been a bit wack, but by the end, i realized that the plot actually fucking slapped. it takes such a brilliantly twisted way to show the price of vengeance & what it takes to forgive. also the twist about amanda's puzzles being just straight-up sinister while john's are somewhat beatable was pretty great. great performances from all. that pig churning scene must have been harrowing to shoot. also, shawnee smith looked really hot.

]]>
pramitheus
Saw II 3r1k1r 2005 - ★★★★★ https://letterboxd.voirfilms24.com/pramitheus/film/saw-ii/ letterboxd-review-884625935 Sat, 10 May 2025 23:39:50 +1200 2025-05-10 Yes Saw II 2005 5.0 215 <![CDATA[

unironically speaking, this was fucking amazing. i think it's kinda better than the first one. the primary motivation being punishing a cop who used fake evidence to convict people, while punishing the convicts because they were criminals anyway was neat. also donnie wahlberg gave the performance of a lifetime. emmanuelle vaugier looked pretty hot.

]]>
pramitheus
Saw 3e36f 2004 - ★★★★★ https://letterboxd.voirfilms24.com/pramitheus/film/saw/ letterboxd-review-884525407 Sat, 10 May 2025 19:16:16 +1200 2025-05-10 Yes Saw 2004 5.0 176 <![CDATA[

i think that foot-cutting scene features some of the rawest acting of all time. james wan should totally make a movie to give leigh whannell another starring role.

]]>
pramitheus
Gaku 3t3b5u One Last Round, 2025 - ★★★★ https://letterboxd.voirfilms24.com/pramitheus/film/gaku-one-last-round/ letterboxd-review-883920886 Sat, 10 May 2025 04:13:10 +1200 2025-05-09 No Gaku: One Last Round 2025 4.0 1474482 <![CDATA[

pretty heartbreaking and aptly portrays the dichotomy of moving out of your home country to become something you are meant to be. like every good short film, it feels too short & doesn't exactly capture the length & breadth of the issue that gaku is talking about. still, it's impactful enough to incite introspection in the most thickheaded, discriminatory, & asinine community in the world: americans.

]]>
pramitheus
Movies Nobody Should Watch Even Once In Their Lifetime 245h6u https://letterboxd.voirfilms24.com/pramitheus/list/movies-nobody-should-watch-even-once-in-their/ letterboxd-list-55176827 Thu, 19 Dec 2024 06:58:08 +1300 <![CDATA[

i'm just tired of seeing lists titled "movies everyone should watch at least once in their lifetime" and it's just the 10000000th compilation of the same movies.

...plus 75 more. View the full list on Letterboxd.

]]>
pramitheus
2025 Stuff u6f5y https://letterboxd.voirfilms24.com/pramitheus/list/2025-stuff/ letterboxd-list-55779937 Mon, 30 Dec 2024 01:20:47 +1300 <![CDATA[

festival release dates, official release dates, limited release dates, these issues persist. so, here's the rule that i'm gonna follow. if a movie has been released in its country of origin before 2025, then it's not gonna be on this list. if a movie has been released in its country of origin in 2025, then it's gonna be on this list. so, if a film got a limited release in their own country in 2024, but had a wider digital release in 2025, it's not gonna be on this list. only if a film had its limited release & wide release in 2025, it's gonna be on this list. hope that's clear.

...plus 290 more. View the full list on Letterboxd.

]]>
pramitheus
2024 Stuff 5b1w4d https://letterboxd.voirfilms24.com/pramitheus/list/2024-stuff/ letterboxd-list-40442519 Mon, 1 Jan 2024 21:23:55 +1300 <![CDATA[

2024 movies & limited series that i watch in 2024 or gets a 2024 wide release. any 2023 limited releases that i have watched in 2023 won't be in this list.

...plus 846 more. View the full list on Letterboxd.

]]>
pramitheus
Single Location Films 722x5o https://letterboxd.voirfilms24.com/pramitheus/list/single-location-films/ letterboxd-list-37563158 Fri, 29 Sep 2023 15:35:07 +1300 <![CDATA[

...plus 176 more. View the full list on Letterboxd.

]]>
pramitheus
Art Mein Ek Sadgi Hai Lekin Artist Suar Hai 4l1p62 https://letterboxd.voirfilms24.com/pramitheus/list/art-mein-ek-sadgi-hai-lekin-artist-suar-hai/ letterboxd-list-62906028 Fri, 2 May 2025 02:00:14 +1200 <![CDATA[

just another way of saying "separating the art from the artist." anyone in the cast and the crew could've been the suar that ruined my full enjoyment of the art.

...plus 67 more. View the full list on Letterboxd.

]]>
pramitheus
Art Mein Toh Sadgi Nahi Hai 664817 Aur Artist Bhi Suar Hai https://letterboxd.voirfilms24.com/pramitheus/list/art-mein-toh-sadgi-nahi-hai-aur-artist-bhi/ letterboxd-list-64203737 Fri, 30 May 2025 08:34:33 +1200 <![CDATA[ ]]> pramitheus 2022 Stuff 3p3w4k https://letterboxd.voirfilms24.com/pramitheus/list/2022-stuff/ letterboxd-list-22292428 Fri, 21 Jan 2022 07:31:50 +1300 <![CDATA[

Just to clarify which movies are definitely 2022 movies and which are 2022 movies but are labelled 2021 because they were initially released in some film festival.

...plus 260 more. View the full list on Letterboxd.

]]>
pramitheus
2023 Stuff d164h https://letterboxd.voirfilms24.com/pramitheus/list/2023-stuff/ letterboxd-list-30014468 Sat, 7 Jan 2023 00:53:21 +1300 <![CDATA[

stuff that had a wide release in 2023.

best and worst ones out of the stuff i have watched.

...plus 265 more. View the full list on Letterboxd.

]]>
pramitheus
Chugga Chugga Choo Choo wl3s https://letterboxd.voirfilms24.com/pramitheus/list/chugga-chugga-choo-choo/ letterboxd-list-26118808 Tue, 2 Aug 2022 15:43:07 +1200 <![CDATA[

"We're a locomotive. We don't stop."

...plus 3 more. View the full list on Letterboxd.

]]>
pramitheus
Movies Which Seem Like It's Going To End 2h1i3d But There's An Hour Left https://letterboxd.voirfilms24.com/pramitheus/list/movies-which-seem-like-its-going-to-end-but/ letterboxd-list-58088074 Thu, 23 Jan 2025 22:57:45 +1300 <![CDATA[ ]]> pramitheus Indian Sequels Which Suddenly Became Obsessed With East Asian Countries 3z6ih https://letterboxd.voirfilms24.com/pramitheus/list/indian-sequels-which-suddenly-became-obsessed/ letterboxd-list-61459958 Mon, 31 Mar 2025 21:01:05 +1300 <![CDATA[

pushpa 2 went to japan. empuraan & its sequel had the shen triad. and sardar 2 is apparently going to china.

]]>
pramitheus
Sequels Where A Fictional Version Of An IRL Bigwig From Gujarat Was Brutally Killed 4u4e3p https://letterboxd.voirfilms24.com/pramitheus/list/sequels-where-a-fictional-version-of-an-irl/ letterboxd-list-61459883 Mon, 31 Mar 2025 20:58:03 +1300 <![CDATA[

i'm not risking my life by saying who's who, that's up to you to decipher.

]]>
pramitheus
Mocobot Used In Indian Cinema 5g6z3v https://letterboxd.voirfilms24.com/pramitheus/list/mocobot-used-in-indian-cinema/ letterboxd-list-53292448 Sat, 2 Nov 2024 21:09:33 +1300 <![CDATA[

had a bit of a hard time finding the name of the camera rig used for those fast but precise 3d moves in some indian movies. so just making this list so that i don't forget the name of the camera rig: MOCOBOT

...plus 7 more. View the full list on Letterboxd.

]]>
pramitheus
This Movie (Or Miniseries) Could've Been An Email 6q2zi https://letterboxd.voirfilms24.com/pramitheus/list/this-movie-or-miniseries-couldve-been-an/ letterboxd-list-28424608 Tue, 22 Nov 2022 23:49:08 +1300 <![CDATA[

A movie (or a miniseries) that thinks its message is so potent that it doesn't need to be interesting or engaging in any way..

...plus 26 more. View the full list on Letterboxd.

]]>
pramitheus
https://letterboxd.voirfilms24.com/pramitheus/list/women-stuck-between-an-explicitly-evil-man/ letterboxd-list-44624889 Mon, 25 Mar 2024 00:22:58 +1300 <![CDATA[

a list of movies that show that when it comes to men, women really have 2 choices: men who are explicitly abusive and/or creepy, and men who hide their abusive/creepy behavior until the opportune moment.

...plus 2 more. View the full list on Letterboxd.

]]>
pramitheus
Middling Movies of 2021 3i85c https://letterboxd.voirfilms24.com/pramitheus/list/middling-movies-of-2021/ letterboxd-list-21358249 Mon, 20 Dec 2021 20:56:10 +1300 <![CDATA[

Movies that were on the brink of being awesome.

...plus 24 more. View the full list on Letterboxd.

]]>
pramitheus
50 Best Indian Action Films 1h234k https://letterboxd.voirfilms24.com/pramitheus/list/50-best-indian-action-films/ letterboxd-list-36922079 Mon, 4 Sep 2023 23:12:57 +1200 <![CDATA[

i need the excusiest of excuses to make a list on action films. btw this isn't ranked. but farhan akhtar's don & don 2 are two of the best action films in indian cinema.
also, even though it doesn't need to be said, this list is based on the movies that I HAVE watched. not claiming that this is the only list about indian action films. i'm sure someone with more time & access to action films from all over india will be a better judge.
mereko kya, main toh batak hu.

...plus 40 more. View the full list on Letterboxd.

]]>
pramitheus
French Faux One Shot Films With A Rich Kid Named Romain 415i63 https://letterboxd.voirfilms24.com/pramitheus/list/french-faux-one-shot-films-with-a-rich-kid/ letterboxd-list-52661205 Fri, 18 Oct 2024 02:58:16 +1300 <![CDATA[ ]]> pramitheus https://letterboxd.voirfilms24.com/pramitheus/list/vigilante-films-where-said-vigilante-realizes/ letterboxd-list-51958545 Mon, 30 Sep 2024 16:51:11 +1300 <![CDATA[ ]]> pramitheus https://letterboxd.voirfilms24.com/pramitheus/list/2024-telugu-films-with-interesting-commentaries/ letterboxd-list-51940963 Mon, 30 Sep 2024 08:26:49 +1300 <![CDATA[ ]]> pramitheus The Crow Movies 5b5z2v Ranked https://letterboxd.voirfilms24.com/pramitheus/list/the-crow-movies-ranked/ letterboxd-list-51382453 Sun, 15 Sep 2024 09:38:04 +1200 <![CDATA[
  1. The Crow
  2. The Crow: Salvation
  3. The Crow: City of Angels
  4. The Crow
  5. The Crow: Wicked Prayer
]]>
pramitheus
Action in 2021 4t276t https://letterboxd.voirfilms24.com/pramitheus/list/action-in-2021/ letterboxd-list-21387645 Wed, 22 Dec 2021 02:15:33 +1300 <![CDATA[

Action movies with action stuff happening. ACTION!
I am counting animation too because why not?

...plus 15 more. View the full list on Letterboxd.

]]>
pramitheus
Best Films of 2021 1o1l15 https://letterboxd.voirfilms24.com/pramitheus/list/best-films-of-2021/ letterboxd-list-21072170 Sun, 5 Dec 2021 05:51:32 +1300 <![CDATA[

Movies that I've given 5 stars, basically.

...plus 46 more. View the full list on Letterboxd.

]]>
pramitheus
Why Doesn't Letterboxd Recognize The Noir Genre? 6i322o https://letterboxd.voirfilms24.com/pramitheus/list/why-doesnt-letterboxd-recognize-the-noir/ letterboxd-list-28041028 Fri, 4 Nov 2022 18:26:35 +1300 <![CDATA[

If you click on the "genre" section, there's no film noir in it. Why?

Also, this list has noir, neo-noir, and slacker noir.

...plus 74 more. View the full list on Letterboxd.

]]>
pramitheus
Shah Rukh Khan Viewing Session 6pw12 https://letterboxd.voirfilms24.com/pramitheus/list/shah-rukh-khan-viewing-session/ letterboxd-list-29454250 Mon, 2 Jan 2023 01:22:26 +1300 <![CDATA[

Trying to finish all theatrically released Shah Rukh Khan films before Pathaan hits the screen. Also, excluding cameos and special appearances.

...plus 56 more. View the full list on Letterboxd.

]]>
pramitheus
Basil Rathbone Sherlock Holmes 322h3i Ranked https://letterboxd.voirfilms24.com/pramitheus/list/basil-rathbone-sherlock-holmes-ranked/ letterboxd-list-50567828 Mon, 26 Aug 2024 03:15:49 +1200 <![CDATA[
  1. The Hound of the Baskervilles
  2. Terror by Night
  3. Dressed to Kill
  4. The House of Fear
  5. The Pearl of Death
  6. The Spider Woman
  7. Sherlock Holmes Faces Death
  8. The Adventures of Sherlock Holmes
  9. The Woman in Green
  10. The Scarlet Claw

...plus 4 more. View the full list on Letterboxd.

]]>
pramitheus
The *insert profession here* Universe 533q3k https://letterboxd.voirfilms24.com/pramitheus/list/the-insert-profession-here-universe/ letterboxd-list-38882812 Fri, 17 Nov 2023 03:59:09 +1300 <![CDATA[

The "The" Universe. It has to be a profession, not a moniker or a title bestowed upon someone or something that describes a character's characteristics, and yes being a witch is a profession.

...plus 69 more. View the full list on Letterboxd.

]]>
pramitheus
The Consequences of Being Polite 5v1s6k https://letterboxd.voirfilms24.com/pramitheus/list/the-consequences-of-being-polite/ letterboxd-list-27057981 Sun, 18 Sep 2022 10:38:52 +1200 <![CDATA[

Movies where characters are too polite to people who are very obviously diabolical as hell & it triggers you because you can see right through the villains' charade but you also understand that if you were in the protagonists' place, you probably would've done the same thing.

]]>
pramitheus
Russell Crowe Is The Christian Dad Of A Queer Child Cinematic Universe 3a1i67 https://letterboxd.voirfilms24.com/pramitheus/list/russell-crowe-is-the-christian-dad-of-a-queer/ letterboxd-list-47784276 Tue, 18 Jun 2024 22:29:11 +1200 <![CDATA[ ]]> pramitheus https://letterboxd.voirfilms24.com/pramitheus/list/films-where-russell-crowe-has-cgi-eyeshadow/ letterboxd-list-47781623 Tue, 18 Jun 2024 20:52:08 +1200 <![CDATA[ ]]> pramitheus Fucking Around (Trying To Cure Alzheimer's Disease By Experimenting On Animals) And Finding Out 394mg https://letterboxd.voirfilms24.com/pramitheus/list/fucking-around-trying-to-cure-alzheimers/ letterboxd-list-47242073 Mon, 3 Jun 2024 08:52:53 +1200 <![CDATA[ ]]> pramitheus Movies In Which Kirsten Dunst's Final Scene Is In A Cemetery 1w6sq https://letterboxd.voirfilms24.com/pramitheus/list/movies-in-which-kirsten-dunsts-final-scene/ letterboxd-list-44295262 Sun, 17 Mar 2024 06:05:22 +1300 <![CDATA[ ]]> pramitheus Movies That Begin With An In n3c2j Movie ment (Or Commercial) https://letterboxd.voirfilms24.com/pramitheus/list/movies-that-begin-with-an-in-movie-ment/ letterboxd-list-43668527 Sun, 3 Mar 2024 10:54:51 +1300 <![CDATA[ ]]> pramitheus Hollywood Movies That Have The Same Name As Thalapathy Vijay Films i634a https://letterboxd.voirfilms24.com/pramitheus/list/hollywood-movies-that-have-the-same-name/ letterboxd-list-43275295 Fri, 23 Feb 2024 09:13:34 +1300 <![CDATA[ ]]> pramitheus Movies Where It's Revealed In The 3rd Act That The Haunted Building Has A Dead Body (Or Bodies) In Its Walls Or Floors 435n41 https://letterboxd.voirfilms24.com/pramitheus/list/movies-where-its-revealed-in-the-3rd-act/ letterboxd-list-20898272 Tue, 23 Nov 2021 21:02:40 +1300 <![CDATA[ ]]> pramitheus If I Had A Rupee For Every Time Shah Rukh Khan Did A Double Role 376nx I Would Have Five Rupees - Which Isn’t a Lot, But It’s Weird It Happened Five Times. https://letterboxd.voirfilms24.com/pramitheus/list/if-i-had-a-rupee-for-every-time-shah-rukh/ letterboxd-list-28213682 Sun, 13 Nov 2022 05:24:03 +1300 <![CDATA[

Shah Rukh Khan is Shah Rukh Khan's favorite co-star, hence, so Shah Rukh Khan can't resist a double role.

]]>
pramitheus
Movie Posters Where The Forest Is Made Of Weapons (Mostly Arrows) 25p2c https://letterboxd.voirfilms24.com/pramitheus/list/movie-posters-where-the-forest-is-made-of/ letterboxd-list-40987042 Sun, 7 Jan 2024 20:46:36 +1300 <![CDATA[

i think i was looking through emma roberts' filmography when i saw this trend in posters where large guns & arrows were blend into the trees of the forest.

]]>
pramitheus
International Film Festival of India 2023 Films That I Watched e4y2i https://letterboxd.voirfilms24.com/pramitheus/list/international-film-festival-of-india-2023/ letterboxd-list-39429991 Tue, 5 Dec 2023 22:56:54 +1300 <![CDATA[

watched over 20 films. did individual reviews for farrey, kadak singh, and rautu ki beli. the rest are here.

...plus 10 more. View the full list on Letterboxd.

]]>
pramitheus
Friday the 13th Ranking 265n4y https://letterboxd.voirfilms24.com/pramitheus/list/friday-the-13th-ranking/ letterboxd-list-38022667 Mon, 16 Oct 2023 07:22:51 +1300 <![CDATA[

finally finished watching all the friday the 13th movies &, contrary to popular opinion, i ended up liking a lot of them.

  1. Friday the 13th: The Final Chapter
  2. Friday the 13th Part VI: Jason Lives
  3. Jason Goes to Hell: The Final Friday
  4. Freddy vs. Jason
  5. Friday the 13th Part VII: The New Blood
  6. Friday the 13th Part VIII: Jason Takes Manhattan
  7. Friday the 13th
  8. Friday the 13th Part 2
  9. Jason X
  10. Friday the 13th Part III

...plus 2 more. View the full list on Letterboxd.

]]>
pramitheus
The Exorcist Films 5q6g1a Ranked https://letterboxd.voirfilms24.com/pramitheus/list/the-exorcist-films-ranked/ letterboxd-list-37837606 Mon, 9 Oct 2023 04:42:53 +1300 <![CDATA[

Wrote a pretty exhaustive article on everything related to The Exorcist (including THE AMAZING TV SHOW THAT EVERYONE SHOULD WATCH). You can read it on Digital Mafia Talkies

  1. The Exorcist III
  2. The Exorcist
  3. Exorcist II: The Heretic
  4. Dominion: Prequel to The Exorcist
  5. Exorcist: The Beginning
  6. The Exorcist: Believer
]]>
pramitheus
YRF SPY UNIVERSE 6r2358 https://letterboxd.voirfilms24.com/pramitheus/list/yrf-spy-universe/ letterboxd-list-30857840 Sun, 29 Jan 2023 01:27:44 +1300 <![CDATA[

well, we have yet another cinematic universe now, which has been confirmed with the release of pathaan.

]]>
pramitheus
Horror Movies Released In The 1st Week Of September 2023 That Opened With A Scene From The 3rd Act 3dw1e https://letterboxd.voirfilms24.com/pramitheus/list/horror-movies-released-in-the-1st-week-of/ letterboxd-list-36959207 Wed, 6 Sep 2023 06:34:39 +1200 <![CDATA[

Surprising that it happened twice!

]]>
pramitheus
Best Films of 2022 22b55 https://letterboxd.voirfilms24.com/pramitheus/list/best-films-of-2022/ letterboxd-list-29216191 Tue, 27 Dec 2022 04:07:47 +1300 <![CDATA[

Movies I've rated between 5-4 stars. the 4 starrers will be the honorable mentions.

Detailed list on Digital Mafia Talkies.

...plus 113 more. View the full list on Letterboxd.

]]>
pramitheus
Movies Like Killer Book Club 3u6519 https://letterboxd.voirfilms24.com/pramitheus/list/movies-like-killer-book-club/ letterboxd-list-36637803 Fri, 25 Aug 2023 22:36:39 +1200 <![CDATA[

Netflix’s Killer Book Club revolves around a group of students—Ángela, Nando, Sebas, Koldo, Sara, Rai, Eva, and Virginia—at an arts and literature university. They are part of a book club where they cover a variety of topics that exist within the horror genre, and their latest obsession is killer clowns. When their literature professor, With, molests Ángela, the group dresses up as clowns to teach him a lesson. Things go south when he takes a tumble and falls to his death. The group promises to bury this secret and never talk about it again. However, someone claiming to be privy to the crime the club has committed promises to go after each of its and write one of the best horror novels out of this experience. This causes the of the club to distrust each other, thereby making it easier for the killer to single them out and murder them brutally. Now, if you are interested in watching movies like Killer Book Club, here’s a list for you.

Click here for my thoughts on why you should watch any or all of them.

...plus 16 more. View the full list on Letterboxd.

]]>
pramitheus
Blue Ghoomer 502q47 Beetle https://letterboxd.voirfilms24.com/pramitheus/list/blue-ghoomer-beetle/ letterboxd-list-36437807 Sat, 19 Aug 2023 00:11:33 +1200 <![CDATA[

at this point i'm listing every double feature that i'm doing cuz it's not an easy task to watch 2 movies back-to-back & then write about em.

]]>
pramitheus
OMGadar 2 5yd3z https://letterboxd.voirfilms24.com/pramitheus/list/omgadar-2/ letterboxd-list-36229401 Fri, 11 Aug 2023 23:22:50 +1200 <![CDATA[

Much like Hollywood's Barbenheimer, two hugely anticipated films with wildly different topics were released by Bollywood on the same day, i.e. August 11, 2023.

]]>
pramitheus
Mommies In 2023 Who Packed A Punch 15d5n https://letterboxd.voirfilms24.com/pramitheus/list/mommies-in-2023-who-packed-a-punch/ letterboxd-list-33894740 Wed, 24 May 2023 22:54:33 +1200 <![CDATA[

They mother-ed hard!

(am i using this phrase correctly)

]]>
pramitheus
Barbenheyroneawaal 6e3f3e Movies Released On July 21 2023 That Comment On Fascism https://letterboxd.voirfilms24.com/pramitheus/list/barbenheyroneawaal-movies-released-on-july/ letterboxd-list-35510918 Sun, 23 Jul 2023 07:53:51 +1200 <![CDATA[ ]]> pramitheus Mission 1o81a Impossible Ranked https://letterboxd.voirfilms24.com/pramitheus/list/mission-impossible-ranked/ letterboxd-list-35249569 Sat, 15 Jul 2023 06:35:53 +1200 <![CDATA[

All Mission: Impossible movies are good. As an Indian, though, I dislike Ghost Protocol cuz it thinks Mumbai & Bangalore are a few blocks apart.

  1. Mission: Impossible – Fallout
  2. Mission: Impossible
  3. Mission: Impossible – Rogue Nation
  4. Mission: Impossible II
  5. Mission: Impossible – Dead Reckoning
  6. Mission: Impossible III
  7. Mission: Impossible – Ghost Protocol
]]>
pramitheus
Spider 5z4l3y Man Films, Ranked https://letterboxd.voirfilms24.com/pramitheus/list/spider-man-films-ranked/ letterboxd-list-21251030 Fri, 17 Dec 2021 01:56:03 +1300 <![CDATA[

It's a ranking of all the feature length Spider-Man films.
Detailed thoughts on High On Films

  1. Spider-Man: Across the Spider-Verse
  2. Spider-Man: Into the Spider-Verse
  3. Spider-Man 2
  4. Spider-Man
  5. Spider-Man 3
  6. Spider-Man: Homecoming
  7. The Amazing Spider-Man 2
  8. Spider-Man: Far From Home
  9. The Amazing Spider-Man
  10. Spider-Man: No Way Home
]]>
pramitheus